• No results found

Chemistry-specific surface adsorption of the barnacle settlement-inducing protein complex

N/A
N/A
Protected

Academic year: 2021

Share "Chemistry-specific surface adsorption of the barnacle settlement-inducing protein complex"

Copied!
36
0
0

Loading.... (view fulltext now)

Full text

(1)

Chemistry-specific surface adsorption of the

barnacle settlement-inducing protein complex

Luigi Petrone, Nick Aldred, Kaveh Emami, Karin Enander, Thomas Ederth and Anthony S. Clare

Linköping University Post Print

N.B.: When citing this work, cite the original article.

Original Publication:

Luigi Petrone, Nick Aldred, Kaveh Emami, Karin Enander, Thomas Ederth and Anthony S. Clare, Chemistry-specific surface adsorption of the barnacle settlement-inducing protein complex, 2015, Interface Focus, (5), 1, 20140047.

http://dx.doi.org/10.1098/rsfs.2014.0047

Copyright 2014: The Author(s). Published by the Royal Society http://royalsociety.org/

Postprint available at: Linköping University Electronic Press

(2)

Chemistry-specific surface adsorption of the barnacle

settlement-inducing protein complex (SIPC)

Luigi Petrone1,3, Nick Aldred2, Kaveh Emami2, Karin Enander1, Thomas Ederth1

& Anthony S. Clare2*

1Division of Molecular Physics, Department of Physics, Chemistry and Biology (IFM),

Linköping University, SE-58183 Linköping, Sweden.

2School of Marine Science and Technology, Newcastle University, NE1 7RU, UK.

3Current address: School of Materials Science and Engineering, Nanyang Technological

University, Singapore.

*Corresponding author: tony.clare@ncl.ac.uk

Abstract

Gregarious settlement in barnacle larvae (cyprids) is induced by a contact pheromone, the settlement-inducing protein complex (SIPC). The SIPC has been identified both in the cuticle of adult barnacles and in the temporary adhesive secretion (footprint) of cyprids. Besides acting as a settlement inducer, the presence of the SIPC in footprints points to its additional involvement in the adhesion process. SIPC adsorption behaviour was therefore investigated on a series of self-assembled monolayers (SAMs) by surface plasmon resonance at the pH of seawater (8.3). Fibrinogen and α2-macroglobulin

(A2M) (blood complement protease inhibitors with which the SIPC shares 29% sequence homology) were used in the adsorption experiments as positive and negative standards, respectively. The mass uptake of the SIPC was comparable to that of fibrinogen, with adsorption observed even on the protein-resistant oligo(ethylene glycol) surface. Notably, on the positively-charged SAM the SIPC showed a kinetic overshoot, indicating a metastable configuration causing the amount of adsorbed protein to temporarily exceed its equilibrium value. A2M adsorption was low or negligible on all SAMs tested, except for the positively-charged surface, indicating that A2M adsorption is mainly driven by electrostatics. Evaluation of SIPC non-specific adsorption kinetics revealed that it adsorbed irreversibly and non-cooperatively on all surfaces tested.

Keywords

Barnacle, Self-assembled monolayer, Surface plasmon resonance, Adhesion, SIPC, Kinetic overshoot

Published in Royal Society Interface Focus, 5(1), 20140047 (2015). DOI: 10.1098/rsfs.2014.0047

(3)

1. Introduction

The settlement-inducing protein complex (SIPC) is a large (~260 kDa native, 169 kDa deglycosylated) glycoprotein, and the principal modulator of conspecific recognition in barnacles [1]. It functions as a contact pheromone, inducing the settlement of cypris larvae as they explore the cuticle-covered exterior of adult barnacles. The SIPC is heavily glycosylated, with M2-9 mannose glycans predominating [2]. The exact role of the glycan moiety is unclear, however it is likely involved in the primary signalling function of the SIPC molecule. Free mannose in solution significantly induces the settlement of cyprids, however the de-glycosylated SIPC molecule also remains active in that regard and both protein and glycan moieties are necessary for the full functionality to be realised.

The SIPC is also present in the 'footprints' of temporary adhesive deposited onto surfaces during exploration by cyprids, thus increasing the likelihood of future cyprid settlement on previously explored surfaces. Although the influence of surface-bound temporary adhesive on subsequently exploring larvae had been recognised decades earlier, it was only recently [3] that the mechanism of induction was attributed with confidence to the SIPC. Immunological experiments performed using antibodies specific to the N- and C-terminal amino acid sequences of the SIPC molecule successfully identified trails of footprints left by larvae exploring a nitrocellulose membrane. For a full discussion of the SIPC and its ecological role in barnacle gregarious settlement, the reader is directed to the review by Clare [1].

Of greater relevance to the present study is the fact that with the identification of SIPC in cyprid temporary adhesive, the possibility arose that SIPC may serve a dual-role, both as a conspecific signalling molecule and as an adhesive. The exact contribution to adhesion made by the temporary adhesive has never been completely clear, however recent work by Aldred et al. [4] strongly supports the original hypothesis that this viscous material is indeed the main functional element in the tenacious and rapidly-reversible attachment of cyprids to surfaces. The implied role of the SIPC in temporary adhesion is not as far-fetched as it may at first seem, when it is considered in the light of an unpublished report of the persistence and stability of this molecule in the marine environment (see Yule and Walker [5]).

The present study was, therefore, designed to investigate the adhesive properties of the SIPC in order to examine its putative role in temporary adhesion. This required investigation of the adsorption characteristics of the intact molecule to a range of well-defined surfaces and also comparison to other relevant proteins in the form of positive and negative standards. The identification of SIPC in the temporary adhesive stemmed from biochemical characterisation of the molecule, via amino acid sequencing, and subsequent identification of the full SIPC open reading frame in the barnacle nuclear DNA. In so doing, it became apparent that the SIPC shares significant sequence homology with the thioester-containing family of proteins that includes the α2

-macroglobulins (A2Ms), including human A2M. A2M was therefore selected as a negative standard - similar in structure to the SIPC, but with no putative adhesive function.

A2Ms are blood complement protease inhibitors, found throughout the animal kingdom. Their function is to inactivate proteolytic enzymes; an action that occurs via

(4)

trapping of the enzymes in a so-called 'bait region'. The whole complex is then identified by macrophages and removed from the system. The relative similarity of the SIPC to commercially available human A2M is, however, difficult to state precisely. Certainly A2M is inert as a settlement cue to barnacles [3] and, unsurprisingly, the SIPC also lacks the highly conserved beta-cysteinyl gamma-glutamyl thioester sequences usually found in A2M-like complement proteins. It is presumed, therefore, that the SIPC plays no role in the immune system of barnacles; a hypothesis supported by the dissimilar sequence of the SIPC and barnacle A2M [3], thus suggesting different roles. It does, on the other hand, have a short sequence likely to be a remnant of a 'bait region' and the similarity in amino acid sequence between SIPC and A2M is nonetheless significant, with 29% similarity to an A2M from Limulus sp. and a tertiary structure consistent with TEP1r from the anti-parasite immune system of the mosquito Anopheles

gambiae (with which it shares 26% sequence homology). It is possible, if not likely,

that the SIPC evolved from an ancestral barnacle A2M gene and, as such, it is not unreasonable to expect structural as well as sequence similarity between the molecules. Indeed, this theory is supported by the work of Pagett et al. [2], who superimposed TEM class averages of the SIPC molecule onto the A2M crystal structure, finding a good visual match.

Fibrinogen (clotting factor I), on the other hand, is totally unrelated to the SIPC in terms of structure and sequence. It is, however, a model protein for molecular adhesion studies having a tendency to adsorb non-specifically to a wide range of surfaces, including so-called non-fouling chemistries like poly(ethylene glycol) (PEG) [6-9]. The PEG surface functionality is strongly hydrophilic, both in its interior and on its surface, retaining a hydration layer of electrostatically bound water molecules at the surface interface and along the chain that makes adsorption impossible for molecules not specifically adapted to the task. Seemingly, (1) steric stabilization, (2) lateral packing density, (3) charge neutrality, (4) chain mobility and conformation, and (5) the unusually low refractive index of PEG (among water-soluble polymers) that makes van der Waals attractions with proteins very low, are also parameters contributing to the protein-repellent nature of PEG and oligo(EG) surfaces [10-14]. Any molecule that even approaches the degree of non-specific surface adsorption demonstrated by fibrinogen, including adsorption to PEG, may therefore be considered to be specifically adapted to the role. For this reason, fibrinogen was included here as a positive standard for adhesion.

To enable comparative investigation of surface adsorption by the SIPC, A2M and fibrinogen we employed surface plasmon resonance (SPR), a highly surface-sensitive optical method frequently used for monitoring biomolecular binding to surfaces based on changes in refractive index. As the specific contribution in refractive index change is assumed to be linearly related to the molecular weight of the biomolecule, SPR is commonly interpreted as a mass sensor. SPR has been used to demonstrate the protein resistance of OEG (EG3OH) and the adhesion of bacterial and

human cells to surfaces [15]. Recently, the nonspecific adsorption of lipoproteins from human blood plasma to antifouling polymer brushes comprising PEG and zwitterionic functionalities was investigated by SPR [16]. Imaging SPR has been used previously to investigate the deposition of cyprid footprints to surfaces and preliminary data relating to SIPC binding on a limited range of surfaces were also obtained [17]. The previous study concluded that footprint deposition was directly correlated to SIPC adsorption, with the exception of a positively charged amine-terminated SAM where

(5)

SIPC adsorption was unexpectedly high relative to footprint deposition data. Since barnacle cyprids are generally reluctant to settle on positively charged surfaces [18-20], this result came as a surprise and required confirmation.

Based upon this rationale, the present study addresses three main hypotheses: 1) that SIPC adsorption to surfaces is chemistry specific, perhaps based upon surface free energy or charge; 2) that due to their structural relatedness, the specificity of the SIPC and A2M would be similar and 3) that the SIPC is, in qualitative terms, a 'sticky' (promiscuously adsorbing) molecule when compared to fibrinogen. If non-specific adsorption by the SIPC is of the same order as fibrinogen and this characteristic is not also possessed by the related A2M molecule, then it would suggest that the SIPC is adapted to maximise surface adsorption and is likely to be involved directly in temporary adhesion by cypris larvae. Improved understanding of cyprid temporary adhesion would benefit not only the development of biomimetic adhesives for rapidly reversible, yet tenacious, underwater adhesion, but also the marine antifouling coatings industry where development of materials to prevent adhesion of marine invertebrate larvae is a priority.

2. Material and methods

Purification of the SIPC. SIPC purification followed the protocol of

Matsumura et al. [21]. Briefly adult barnacles, Balanus amphitrite (=Amphibalanus

amphitrite) [22] from Beaufort North Carolina were snap-frozen, quickly homogenised

and the crude protein extract, buffered throughout at pH 7.5, was subjected to salt precipitation and dialysis. Following dialysis the crude extract was purified further using ion exchange and size exclusion chromatography. After each step, relevant fractions were identified by Western blotting of a representative sample using an antibody specific to a 76 kDa subunit of the SIPC. The protein used for experiments, prepared using this process, was therefore intact and non-denatured.

Determination of SIPC pI. Protein fractions containing the SIPC were collected from a BioLogic LP system (Biorad) following completion of the chromatography stages referred to above. The active fractions, identified by Western blotting, were further separated by SDS-PAGE to confirm the presence of SIPC sub-units. Those containing the SIPC were subjected to isoelectric focusing (IEF) in a 24-well OFFGEL fractionation system (3100 OFFGEL Fractionator, Agilent Technologies). In this method, a liquid sample is applied in wells along the length of a 24 cm immobilized pH gradient strip (ReadyStripsTM IPG Strips pH 3-10, Biorad). -Galctosidase from A. oryzae (Sigma), Cytochrome C from equine heart (Sigma), and commercial IEF standards (IEF standards pI 4.45-9.6, Biorad) were subjected to simultaneous separation procedures on different strips for reference. Sample preparation and the OFFGEL fractionator protocol were followed exactly as per the manufacturer’s recommendations (Agilent Technologies OFFGEL Fractionator User Guide). Following the IEF separation procedure, proteins were eluted back into the wells situated above their final location on the IEF strip. The contents of all wells were then removed and once again run on a SDS-PAGE gel followed by Western blotting using an antibody specific to the N-terminal sequence of the B. amphitrite SIPC [23]. The location of the stained fraction (well number) relative to the standards mentioned above provided a measure of the pI of the SIPC.

(6)

Preparation of self-assembled monolayers. Five types of self-assembled

monolayers (SAMs) were used in SPR experiments. The surfaces were prepared as follows: 12 x 12 mm2 glass SPR chips coated with a 45 nm thick layer of gold (acquired from GE Healthcare, Uppsala, Sweden) were washed in a 5:1:1 mixture of Milli-Q water, 30% hydrogen peroxide and 25% ammonia (TL-1) at 85 °C for 5 minutes. The slides were then rinsed with water and ethanol and placed in thiol solutions overnight prior to testing. The following thiols were used: HS(CH2)10CH3 (Fluka, Germany),

HS(CH2)11OH (Prochimia, Poland), HS(CH2)10COOH (Sigma-Aldrich, Germany),

HS(CH2)11N(CH3)3+ Cl- (Prochimia, Poland) and HS(CH2)10CONH(C2H4O)11CH3

(Polypure AS, Norway). These treatments produced surfaces with homogeneous methyl (CH3), hydroxyl (OH), carboxyl (COO-), trimethylamine (N(CH3)3+) and

oligo(ethylene glycol) (OEG) chemistry, respectively. Prior to the analyses, SPR chips were incubated for 24 h in 100 M thiol solutions in 99.5% ethanol. The chips were subsequently sonicated, washed with ethanol and blow dried under a stream of nitrogen. Advancing water contact angles were 107 ±1° for CH3, 60 ±2° for N(CH3)3+, 45 ±3°

for COO-, 39 ±2° for OH and 33 ±2° for OEG. Additional information on ellipsometric thicknesses, surface free energies and infrared reflection absorption spectra can be found in Petrone et al. [18] Aldred et al. [17], Di Fino et al. [20] and Petrone et al. 2013 [19].

Surface Plasmon Resonance. SPR experiments were conducted using a Biacore 3000

unit (GE Healthcare, Uppsala, Sweden) operated at 25 °C and at a flow rate of 10 μL/min. Tris-base (0.05 M, pH 8.3; Sigma) was used as a running buffer. Solutions of SIPC, fibrinogen (Sigma) and α-2-macroglobulin (A2M; Sigma) were made up in running buffer, which had been selected to approximate the native conditions for SIPC. After docking the SPR chip into the instrument, running buffer was allowed to equilibrate the surface for 3 minutes, followed by a 3-min period of protein injection (30 μL). After this injection, running buffer was allowed to flow over the chip for 5 minutes to ensure a stable plateau was reached after desorption of loosely bound molecules. Data are presented as absolute differences in resonance units (RU) immediately before protein injection and 300 s after the end of injection. Resonance units were converted into mass uptake of proteins (Δm) via the following relation: Δm = CSPRΔRU

where CSPR corresponds to 6.510-2 ngcm-2 for the adsorption of proteins to flat

surfaces [24,25]. Three replicate measurements were collected for each protein on each surface chemistry (different surface per replicate) allowing later comparison by general linear model analysis of variance (GLM ANOVA) and Tukey post-hoc comparisons in Minitab 15. Since SPR can determine the mass of the adsorbed analyte, protein concentrations were in weight per volume (mg/mL) rather than moles per volume (molar concentration). This approach allowed direct comparison between the proteins in terms of their adsorption to the chosen SAMs.

Accurate rate constants for the nonspecific adsorption process could not be calculated, since the protein density on the SAM at saturation depends on the concentration of protein in the buffer. It was, nevertheless, possible to draw certain conclusions regarding the kinetics of adsorption. In such circumstances, Mrkisch et al.

(7)

[6] suggested a kinetics analysis to determine the initial rate of protein adsorption by plotting the initial change in resonance units (ΔRU during a chosen time interval) as a function of the bulk protein concentration. In this work, the initial rates of adsorption of the SIPC at various bulk concentrations (0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL) were evaluated on the five SAM surfaces. The slope of the fitted linear trends (ΔRU/s

vs. protein bulk concentration) relates directly to the initial rate of adsorption of the

SIPC to the test surfaces.

The first second of data, immediately following injection of the protein, was disregarded in the ensuing calculations to circumvent aberrations related to bulk refractive index differences between running buffer and sample. Determination of the exact increase in refractive index within ~200 nm from the surface (the SPR probe depth) is daunting since the instant response shift may also, in part, be due to a contribution from rapid adsorption of protein molecules onto the SAM. The RU value 1 second after injection of the SIPC solution (t1) was therefore subtracted from that at 2 (t2) and 5 s (t5), and the resulting values (with the value in the t5-t1 interval divided by

4) were considered to be indicative of the SIPC initial rate of adsorption.

3. Results

3.1 Isoelectric point of the SIPC

Western blots identified proteins with SIPC-specific immunological activity in wells 6 and 7 of the OFFGEL fractionation system. -Galactosidase and phycocianin, with pIs of 4.5 and 4.6 respectively, were also found in similar positions in IEF system. On the basis of these observations, the pI of the SIPC was therefore estimated to be 4.6 - 4.7 which is in the region predicted by the amino acid sequence.

3.2 Protein adsorption on SAMs

Adsorption of the SIPC, fibrinogen and A2M onto a range of SAMs was measured by SPR at a concentration of 0.1 mg/mL at pH 8.3, and the results are presented in Figure 1. Taken across all surfaces, the three proteins gave different responses (F = 138, P = <0.001) and Tukey pairwise comparisons (Table 1 in ESI) suggested that all three proteins differed significantly from each other in terms of total adsorption to surfaces. There was also a significant effect of surface, when considering all proteins together (F = 295.44, P = <0.001). Surfaces clustered into three groups, where N(CH3)3+ had the

highest adsorption of proteins overall, followed by COO- and CH

3 (which did not differ)

and then OH and OEG with the lowest adsorption overall. The SPR data presented a clear ranking of adsorption for the three proteins under investigation on all surfaces, except for the N(CH3)3+ SAM (Fig. 1) where A2M responded differently. In fact, on all

but the positively charged surface, fibrinogen had the highest adsorbed mass, followed by SIPC and then A2M. In the case of N(CH3)3+ SAM, the largest adsorbed mass was

that of A2M which was lowest on all other surfaces. Interestingly, the SIPC adsorbed equally well to the two oppositely charged surfaces.

In statistical terms, there was also a significant GLM ANOVA interaction term (F = 49.87, P = <0.001) between proteins and surfaces, as would be expected from looking at the data in Figure 1. I.e. different proteins adsorbed in different amounts, depending on the specific surface chemistry of the substrate. It is not necessary to consider here all possible combinations in the analysis (Table 1 in ESI), so specific examples are used

(8)

for illustrative purposes: the differences in adsorbed mass of SIPC, fibrinogen and A2M were significant on the CH3 and COO- SAMs, but there was no effect of surface on

adsorption of the different proteins - i.e. each protein responded similarly to these two surfaces, although there were differences between proteins in terms of absolute adsorption. Similarly, there were no differences in the response of proteins to OH and OEG, although for both of these surfaces adsorption of A2M was significantly lower than that of fibrinogen and SIPC, which did not differ. For N(CH3)3+, A2M adsorption

was significantly higher than SIPC and fibrinogen. SIPC adsorption did not differ between CH3, COO- and N(CH3)3+, however adsorption of fibrinogen was significantly

lower on N(CH3)3+ compared to CH3 and COO-.

In the context of the study, the important findings were that for OH, OEG and N(CH3)3+

SAMs the adsorption values for SIPC and fibrinogen were similar. Adsorption of fibrinogen was also significantly reduced by the presence of a positive surface charge, whereas adsorption of SIPC was not. Adsorption of SIPC was only significantly lower than fibrinogen on the CH3 and COO- surfaces and, even so, was still considerably

higher than A2M. Adsorption of A2M was very low across the range of surfaces tested, with the exception of N(CH3)3+. SIPC showed much higher adsorption that more

closely resembled that of fibrinogen on the charged SAMs and the hydrophilic neutral SAMs (OH and OEG). On the basis of these data, it was immediately apparent that SIPC was markedly different to A2M in terms of its adsorption characteristics, and that its behaviour was broadly similar to that of fibrinogen on the surfaces tested.

3.3 Kinetics of adsorption of the SIPC

In addition to total adsorbed mass, the kinetics of initial adsorption of SIPC was assessed on the five SAMs. SPR sensorgrams in Figures 2, 3, 4, 5 and 6 show the adsorption of SIPC at five concentrations (0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL) on N(CH3)3+, COO-, CH3, OH, and OEG SAMs. On all SAMs the initial rate of SIPC

adsorption increased as a function of its bulk concentration, as qualitatively visible from the slopes of the initial part of the SPR curves (see Fig. 1-5 in ESI). On the contrary, on the positively charged N(CH3)3+ surface, the total amount of adsorbed SIPC was

highest for the lowest concentration (0.005 mg/mL), followed in ascending order by the protein at a concentration of 0.0125, 0.1, 0.025 and 0.05 mg/mL (Fig. 2).

The initial SIPC adsorption rates were calculated via a linear fit to the data in the intervals t1-t2 and t1-t5 for each concentration, for each SAM. These rates are plotted

versus the solution concentrations in Figure 7. For each SAM chemistry, the rates appear to vary linearly with solution concentration, and linear fits to the rates for a particular SAM yield the slopes indicated in Figure 7, and summarized in Table 1. Both intervals lead to the same trend for the adsorption rate of the SIPC on the SAMs tested. Kinetics calculations were also performed by neglecting the initial 2 s of SIPC injection, and resulted in comparable results (data not shown). The linear increase in adsorption rate with increasing solution concentration for all SAMs is indicative of first-order rate constants, consistent with irreversible and non-cooperative SIPC adsorption on all SAM chemistries [6,26].

(9)

The relative amount of the SIPC desorbed from each SAM upon buffer wash is reported in ESI Figure 6. The data reported as percentage of desorbed protein (% desorbed) as a function of concentration show that the highest value (33.6%) was recorded for the OH SAM at 0.1 mg/mL, followed by the OEG SAM (26.9%) at the same concentration. Generally, the desorbed amount percentage increased with the SIPC concentration on each surface. The lowest desorbed percentage was on the positively (3.6%) and negatively (5.9%) charged SAMs, with the CH3 SAM showing

intermediate values.

4. Discussion

The adsorption of three proteins, namely SIPC, fibrinogen and A2M was measured on a range of thiol SAMs using surface plasmon resonance. The functional end-groups were suitably chosen to impart hydrophilic, hydrophobic, neutral and charged characters to the SAMs. Fibrinogen is a large blood plasma protein (340 kDa, pI 5.3-6.1) known to adsorb strongly to a variety of surfaces, and it is thus often used as a ‘sticky’ model protein for comparative purposes [27]. Tetrameric A2M (760 kDa, pI 5.3) [28] was included in this study as it shows a significant homology with SIPC (29%). The pI of the ~260 kDa SIPC molecule was found to be 4.6 - 4.7. At the pH of seawater (8.3), selected for the experiments, all proteins therefore possessed a net negative charge.

The importance of ionic strength and pH should be acknowledged here since these factors certainly affect the range of forces implicated in the molecular adsorption mechanism; electrostatic interactions, hydrogen bonding, molecular conformation, etc. The effect of ionic strength on the adsorption behaviour of the SIPC thus demands further investigation. As explained previously, a pH of 8.3 was chosen to approximate the native conditions in which the SIPC exercises its putative adhesive role and to maintain consistent experimental conditions between treatments. There are, however, some complicating factors. Upon discharging their adhesive material, some organisms have been shown to manipulate the local pH so that it differs from the ambient seawater [29,30], providing conditions conducive to the chemistry of adhesion. In the case of mussels and tubeworms, the secretory granules containing adhesive components have an acidic pH [29,31]. Similarly, an acidic pH has been detected in the cement glands of adult stalked barnacles, Lepas anatifera [32]. Further, two of the test proteins (fibrinogen and A2M) have evolved to perform their respective functions under physiological pH, so the experimental conditions here take them slightly out of context. While imperfect, therefore, the present study provided a 'level playing field' for all proteins in conditions relevant to the protein of interest, the SIPC, and the findings should be considered with this in mind.

The SIPC and fibrinogen both adsorbed irreversibly to negatively charged surfaces under conditions where they too carry a net negative charge. Notably, fibrinogen adsorption was reduced on the positively-charged SAM, compared to the negatively-charged surface, whereas there was no reduction in SIPC adsorption. While A2M adsorbed irreversibly on the N(CH3)3+ SAM, it was significantly reduced on the COO

-SAM. The adsorption of all proteins was relatively low on OH and OEG SAMs (protein-resistant surfaces). SIPC and fibrinogen adsorbed in equally small yet quantifiable amounts, whilst A2M adsorption was negligible on OH SAM and undetected on OEG SAM. Protein net charge alone is therefore insufficient to explain

(10)

protein adsorption on charged surfaces. This may be due to the role of non-charge interactions, or the patchiness of charged domains where local charge distributions allow proteins to interact with both negatively and positively charged surfaces, depending on the orientation of the molecule [33].

Upon adsorption and binding to a surface, the electron density within the intramolecular bonds of any molecule inevitably undergoes a structural change. Therefore, the structural changes referred to in this work denote major unfolding, denaturating and reorientational events. Proteins might unfold to various degrees undergoing conformation and (re)orientational changes. Restructuring may lead to a conformational entropy gain, which can constitute the driving force for adsorption even under conditions of electrostatic repulsion, as observed for the adsorption of SIPC and fibrinogen on a like-charged surface in this SPR study. Additionally, for proteins with a given net charge, adsorption onto like-charged surfaces can be driven by attachment of regions on the protein with opposite charge, and further conformational changes from this state may promote stronger attachment. It is unlikely that the SIPC would have evolved this capability by chance and the most plausible explanation for the similarity in adsorption characteristics between the SIPC and the promiscuously adsorbing fibrinogen, therefore, is that both have similar roles in their respective systems - as 'sticky' proteins. The evidence from this preliminary adsorption study thus provides support for the involvement of the SIPC in barnacle cyprid temporary adhesion to the diversity of immersed surfaces that larvae might encounter in nature. The SIPC and A2M show significant sequence similarity (29% perfect amino acid matches) and, therefore, the prominent discrepancy in adsorption behavior appears to derive from parameters other than their primary sequences. As displayed in Figure 7 in ESI from the pairwise sequence alignment, in addition to the perfect amino acid matches (398 residues), there is a significant number of amino acids (358 residues that score >0.5 in the Gonnet PAM 250 matrix) with strongly similar properties and others (229 residues that score ≤0.5 in the Gonnet PAM 250 matrix) with weakly similar properties. Besides their homology, the pairwise comparison shows that the SIPC and A2M are highly conserved proteins throughout the entire sequences, and differences in their adsorption behavior have to be sought in aspects other than their primary sequences.

Furthermore, a comparison of the total amino acid composition (see Table 2 in ESI) shows that the SIPC contains higher proportions of arginine and aspartic acid, whereas the relative content of histidine is greater in A2M. Arginine and aspartic acid have a hydrophaty index of -4.5 and -3.5, respectively, and histidine has an index of -3.2 (the lower the hydrophaty index, the greater the hydrophilic nature of an amino acid). This comparison indicates that higher amounts of arginine and aspartic acid in the SIPC confer greater hydrophilicity to the SIPC as compared to A2M. The grand average of hydropathicity (GRAVY) of the SIPC is -0.304, whereas A2M is -0.195, indicating that the SIPC is indeed more hydrophilic than A2M.

Another difference between the SIPC and A2M is revealed by aligning their primary sequences, showing that an insert of 60 amino acids (GQSTPEGTPE SETSGAAHSS LFIPPPTRSQ RFRTDREDAI KPFDEAGFLV LSNLALETRP), located in the SIPC 706766 region, is missing in A2M. Notably, the GRAVY index for this sequence is -0.697, which is lower than the corresponding values for both proteins. However, it

(11)

would be highly speculative to provide an explanation for the discrepancy in adsorption behavior of the SIPC and A2M based solely on this sequence, or on the proteins’ GRAVY index. Data relating to the conformations adopted by the SIPC in solution and on surfaces are needed. In addition, glycosylation of the proteins provides further complication since the 60 amino acid insert in the SIPC may well be glycosylated, thus causing the GRAVY index to differ from the predicted values based on its primary sequence.

A kinetic study was carried out to obtain semi-quantitative measurements for the adsorption of SIPC to the range of SAMs tested. SIPC at 5 concentrations (0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL) was injected into the SPR flow cell and the accumulation of mass on the surfaces was quantified. The SPR sensorgrams in Figures 2-6 show an increase in the total adsorbed amount of SIPC as a function of its bulk concentration. Interestingly, this trend was not observed on the positively charged SAM, where the lowest concentration (0.005 mg/mL) resulted in the highest adsorbed amount of SIPC (see Fig. 2). A possible explanation for this unusual pattern of adsorption on the N(CH3)3+ SAM is visible in the ascending portion of the SPR curves

at higher concentrations. At 0.1 mg/mL, the SPR curve shows a maximum after 7 s of SIPC injection peaking at 3048 RU. RU subsequently drops rapidly to 2850 RU at 15 s and then stabilizes to 2800 RU in the following few seconds. It is tempting to disregard such trends as anomalous artefacts, but in reality such a curve can be ascribed to an overshooting effect manifesting a local maximum during the adsorption, exceeding temporarily its equilibrium value [33]. A likely explanation relates to orientational rearrangement that occurs upon adsorption of the SIPC on the positively-charged SAM. Wertz et al. [34] and Daly et al. [35] reported an overshooting effect for the adsorption of fluorescently-labelled lysozyme on hydrophilic and hydrophobic surfaces at pH 7.4, caused by the orientational change of adsorbed molecules from an initial end-on to a final side-on orientation with respect to the surface. Assuming similar adsorption behaviour in the case of the SIPC on the N(CH3)3+ SAM, electrostatic interactions could

initially drive the rapid adsorption of the net negatively-charged SIPC on the positively-charged surface in an end-on orientation. Subsequently, the reorientation of the SIPC molecules into a more tightly adhering side-on position would displace more loosely bound SIPC molecules that remained in an end-on orientation.

Besides reorientation, conformational changes during protein adsorption are recurrent, enhancing the affinity for a surface. Plausible mechanisms are presented schematically in Figure 8, with both (a) (re)orientational and (b) conformational changes of adsorbed SIPC on N(CH3)3+ SAM. Both rotational and conformational changes cause the

adsorbed proteins to increase their surface area in contact with the substrate, thus leading to stronger adsorption and energetically favoured states. These phenomena would explain the decrease in total adsorbed mass and the drop evident in the SPR curves with increasing protein concentration presented to the surface. The overshooting effect was still manifest experimentally at lower SIPC concentrations (0.05, 0.025 and 0.0125 mg/mL), becoming undetectable at the lowest solution concentration of 0.005 mg/mL, as the coverage monotonically approached its final value.

A mathematical model for the overshooting kinetics of solutes at liquid/solid interfaces based on the time delay (τ) was proposed by Ohshima et al. [36]. Solutes with complex structures require some time, denoted as τ, to desorb from a solid surface as a result of their conformation and/or orientational rearrangements. In the period 0 ≤

(12)

t ≤ τ only adsorption occurs, and at t = τ desorption begins in addition to adsorption. If

τ is sufficiently large, the total adsorbed amount of solute can exceed its equilibrium value, thus causing an overshoot. From Figure 4, τ can be deduced from the sensorgrams for each of the four SIPC concentrations as the maximum during adsorption (prior to buffer wash), namely at τ1=7 s, τ2=19 s, τ3=45 s and τ4=107 s, corresponding to 0.1, 0.05, 0.025 and 0.0125 mg/mL respectively. At τ1, τ2,τ3 and τ4 the

surface concentration of the SIPC corresponds to 198, 155, 164 and 165 ng/cm2 respectively. At these concentrations it can thus be assumed that the rate of conformational change and/or reorientation of the SIPC is lower than its adsorption rate, thus causing the kinetic overshoot.

A marked difference was observed in the relative amount of SIPC desorbed from SAMs upon buffer wash (see Fig. 6 in ESI). A surface that denatures a protein at a faster rate will show a lower tendency towards desorption. In fact, desorption has been shown to correlate strongly to protein stability [37], i.e. the more denaturating a surface, the lower the desorbed protein amount. On the other hand, a higher amount of protein desorption suggests both slower denaturation rate and a lesser degree of denaturation. The least denaturing of the SAMs during the SIPC adsorption are OH and OEG, on which lower total adsorption occurs. The CH3 SAM is intermediate, while COO- and

N(CH3)3+ SAMs show the lowest relative desorption, corresponding to the greatest

SIPC denaturation. More specifically, on the positively-charged surface, the minimum desorption percentage of the SIPC at 0.005 mg/mL was 3.6%, which then increased to 5.1, 9.8, 12.8 and 17.3% at, respectively, 0.0125, 0.025, 0.05 and 0.1 mg/mL. Therefore, the lowest SIPC concentration showed the greatest degree and/or rate of denaturation and, as its concentration increased, the rate of interfacial denaturation decreased. These observations corroborate the assumption that the experimentally-observed overshoot kinetic was mainly due to the rate of adsorption overcoming the rate of denaturation at concentrations higher than 0.005 mg/mL.

The highest total adsorbed mass for the SIPC at the lowest bulk concentrations of 0.005 mg/mL can be tentatively explained by the slower rate of adsorption. At low bulk concentrations of SIPC, the surface coverage is maximized, possibly because all SIPC molecules are able to maximize their surface area in contact with the substrate when there are few neighbours. This would increase the fraction of tightly bound molecules and the total adsorbed mass would be augmented.

Regarding the kinetic analysis of SIPC initial adsorption, the initial second of protein injection in the sensorgram adsorption curves was ignored to exclude artefacts presented by the refractive index mismatch between running buffer and the sample [38,39]. The SIPC injection during t1-t2 and t1-t5 interval were considered to be

indicative of the initial phase of protein adsorption on the range of SAMs tested. In fact, regardless of the interval chosen, the trends of SIPC initial adsorption rates were consistent, showing linear dependence as a function of SIPC bulk concentration on each SAM (see Fig. 7). Such linear fitting denotes a first-order rate constant, indicative of irreversible and non-cooperative SIPC adsorption on all SAMs. As reported in Table 1, the values of the slopes of the linear relations in Figure 7 show the same trend for the two intervals, revealing that the initial SIPC adsorption rate was highest on N(CH3)3+,

(13)

An adsorption mechanism that can create first order rate constants can be explained as follows: as the protein adsorption starts, the planar, chemically and physically homogenous SAM surface available for binding can be considered infinite, and the resulting initial adsorption kinetics are of the first order (very low sorbate/sorbent ratios). The exclusion of the initial second of adsorption still results in first order kinetics, thus showing that the surface is not overpopulated by adsorbed proteins and can thus be considered as infinite for the chosen time course. Additionally, the initial protein adsorption takes place on surface sites where no other proteins are present and consequently lateral and cooperative interactions are negligible.

The finding in this work correlates directly with the previous study by Aldred et al. [17] in which the SIPC was shown to have highest adsorption to a positively-charged amine-terminated (-NH3+) SAM (N.B. different SAM termination to the present study,

different barnacle species and different SIPC purification apparatus yielding a comparable result). However, following surface exploratory behaviour of cyprids, less temporary adhesive material was detected on this surface compared to e.g. a COO

-SAM. The relation between the SIPC adsorption and adhesive footprint retention by the other SAMs tested was directly proportional. There are several possible explanations for the dissimilarity of the footprint and the SIPC adsorption data for positively charged SAMs. First, it is possible that cyprids somehow 'choose' to deposit fewer footprints on the positively charged surfaces, although no physiological/behavioural mechanism has been described that would allow this and it also seems unlikely in the context of data suggesting a direct correlation between footprint deposition and passive protein adsorption for the other surfaces tested. Second, the cyprid footprints/temporary adhesive could contain other adhesive components, in addition to the SIPC, that could moderate the intrinsic preference of pure SIPC for adsorbing to positively charged surfaces. Last, it is possible that the overshooting effect described above plays a role. If the temporary adhesive footprint is pure SIPC, the immediate saturation of the surface by the SIPC molecules when the cyprid makes contact could lead to extensive reorganisation that favours cohesion of the footprint and retention on the adhesive disc, rather than deposition to the surface. After all, positively charged surfaces in the marine environment are presumably rare, and it would be surprising if the temporary adhesive mechanism had adapted to these specifically.

These data present the first mechanistic evidence to support the role of the SIPC in cyprid temporary adhesion to surfaces. In the context of the present study, the SIPC performed comparably with fibrinogen and its adsorption characteristics were not shared by the closely-related A2M. It is clear, therefore, that the SIPC is a 'sticky' protein. It also seems reasonable to conclude, based upon these quantitative findings and the identification of the molecule as a component of cyprid footprints, that the SIPC could also be an adhesive protein. New findings by Gohad et al. [40] revealed that the adhesive secretion of cyprids comprises a by-phasic system of lipids and phosphoproteins, synergistically acting to maximize underwater adhesion. Future studies should aim towards definitive identification of the component(s) of the temporary adhesive of cyprids, for instance by integrating high-throughput RNA-seq with proteomics [41,42] in order to ascertain whether the SIPC is 'acting alone' or ‘in concert’ with lipoproteinaceous compounds [40]. If the first case a range of possibilities opens, from use of SIPC adsorption as a rapid assay for approximation of cyprid adhesion, to further investigation of the properties of the SIPC molecule that make it so

(14)

promiscuously adsorbing. The former has the potential for establishing e.g. a rapid down-selection assay for fouling resistant chemistries, while the latter may produce findings that can be translated into the development of bio-inspired adhesives.

5. Conclusions

 The SIPC appears to be a 'sticky' (promiscuously adsorbing) protein with adsorption characteristics more closely resembling those of fibrinogen than the related A2M molecule. This supports a putative role in the temporary adhesion of barnacle larvae to surfaces. Further investigation of this molecule will be required to better understand the mechanism of surface adsorption and potential routes to exploitation.

 The SIPC adsorbed, on all of the SAMs tested, in similar quantities to fibrinogen, exemplifying its ability to interact with diverse surfaces including protein-resistant surfaces such as OEG. Like fibrinogen, adsorption of the SIPC was increased by the presence of a positive or negative surface charge.

 SIPC adsorption was higher than that of A2M for all surfaces, except for the positively charged N(CH3)3+ SAM, indicating a prevalence of ionic interactions

during the A2M adsorption process. The kinetics of initial adsorption differed for SIPC between the COO- and N(CH3)3+ SAMs, with faster initial adsorption

to the N(CH3)3+ SAM.

 The linearity of the initial rate of adsorption for SIPC indicated first-order rate constants consistent with irreversible and non-cooperative adsorption mechanisms on all SAMs.

 The kinetic overshoot observed on the positively-charged SAM can be ascribed largely to conformational changes, as the rate of adsorption overcame the rate of denaturation at concentrations higher than 0.005 mg/mL.

Acknowledgements

This study has received funding from the European Community’s Seventh Framework Program FP7/2007–2013 under Grant Agreement number [237997] (SEACOAT). Nick Aldred would like to acknowledge Office of Naval Research grant N00014-08-1-1240 to A.S.C for financial support, as well as COST Action TD0906 for two Short-Term Scientific Missions to Linköping, during which the experimental work was carried out.

(15)

References

[1] Clare, A. S. 2011 Toward a characterization of the chemical cue to barnacle gregariousness. In Chemical communication in crustaceans (eds T. Breithaupt, M. Thiel), pp.431-450. New York: Springer.

[2] Pagett, H. E., Abrahams, J. L., Bones, J., O'Donoghue, N., Marles-Wright, J., Lewis, R. J., Harris, J. R., Caldwell, G. S., Rudd, P. M., Clare, A. S. 2012 Structural characterisation of the N-glycan moiety of the barnacle settlement-inducing protein complex (SIPC). J. Exp. Biol. 215, 1192-1198. (DOI 10.1242/jeb.063503)

[3] Dreanno, C., Matsumura, K., Dohmae, N., Hirota, H., Kirby, R. R., Clare, A. S. 2006 An α2-macroglobulin-like protein is the cue to gregarious settlement of the

barnacle. Proc. Natl. Acad. Sci. U.S.A. 103, 14396-14401 (DOI 10.1073/pnas.0602763103)

[4] Aldred, N., Høeg, J. T., Maruzzo, D., Clare, A. S. 2013 Analysis of the behaviours mediating barnacle cyprid reversible adhesion. PLoS ONE 8, e68085. (DOI 10.1371/journal.pone.0068085)

[5] Yule, A. B., Walker, G. 1987 Adhesion in barnacles. In Barnacle biology,

crustacean issues 5 (ed A. J. Southward), pp. 389-402. Rotterdam: A.A. Balkema.

[6] Mrksich, M., Sigal, G. B., Withesides, G. M. 1995 Surface plasmon resonance permits in situ measurement of protein adsorption on self-assembled monolayers of alkanethiolates on gold. Langmuir 11, 4383-4385. (DOI 10.1021/la00011a034)

[7] Harder, P., Grunze, M., Dahint, R., Whitesides, G. M., Laibinis, P. E. 1998 Molecular conformation in oligo(ethylene glycol)-terminated self-assembled monolayers on gold and silver surfaces determines their ability to resist protein adsorption. J. Phys. Chem. B 102, 426-436. (DOI 10.1021/jp972635z)

[8] Hu, Y., Jin, J., Han, Y., Yin, J., Jiang, W., Liang, H. 2014 Study of fibrinogen adsorption on poly(ethylene glycol)-modified surfaces using a quartz crystal microbalance with dissipation and a dual polarization interferometry. RSC Adv. 4, 7716-7724. (DOI 10.1039/C3RA46934D)

[9] Jin, J., Jiang, W., Yin, J., Ji, X., Stagnaro, P. 2013 Plasma proteins adsorption mechanism on polyethylene-grafted poly(ethylene glycol) surface by quartz crystal microbalance with dissipation. Langmuir 29, 6624−6633. (DOI 0.1021/la4017239) [10] Herrwerth, S., Eck, W., Reinhardt, S., Grunze, M. 2003 Factors that determine the protein resistance of oligoether self-assembled monolayers - internal hydrophilicity, terminal hydrophilicity, and lateral packing density. J. Am. Chem. Soc. 125, 9359-9366. (DOI 10.1021/ja034820y)

[11] Jeon, S., Andrade, J. 1991 Protein−surface interactions in the presence of polyethylene oxide: II. Effect of protein size. J. Colloid Interface Sci. 142, 159−166. (DOI 10.1016/0021-9797(91)90044-9)

(16)

[12] Jeon, S., Lee, J., Andrade, J., De Gennes, P. 1991 Protein−surface interactions in the presence of polyethylene oxide: I. Simplified theory. J. Colloid Interface Sci. 142, 149−158 (DOI 10.1016/0021-9797(91)90043-8).

[13] Larsson, A., Ekblad, T., Andersson, O., Liedberg, B. 2007 Photografted poly(ethylene glycol) matrix for affinity interaction studies. Biomacromolecules 8, 287−295. (DOI 10.1021/bm060685g)

[14] Ekblad, T., Bergström, G., Ederth, T., Conlan, S. L., Mutton, R., Clare, A. S., Wang, S., Liu, Y., Zhao, Q., D’Souza, F., et al. 2008 Poly(ethylene glycol)-containing hydrogel surfaces for antifouling applications in marine and freshwater environments.

Biomacromolecules 9, 2775–2783. (DOI 10.1021/bm800547m)

[15] Ostuni, E., Chapman, R. G., Liang, M. N., Meluleni, G., Pier, G., Ingber, D. E., Whitesides, G. M. 2001 Self-assembled monolayers that resist the adsorption of proteins and the adhesion of bacterial and mammalian cells. Langmuir 17, 6336-6343. (DOI 10.1021/la010552a)

[16] Gunkel, G., Huck, W. T. S. 2013 Cooperative adsorption of lipoprotein phospholipids, triglycerides, and cholesteryl esters are a key factor in nonspecific adsorption from blood plasma to antifouling polymer surfaces. J. Am. Chem. Soc. 135, 7047−7052. (DOI 10.1021/ja402126t)

[17] Aldred, N., Ekblad, T., Andersson, O., Liedberg, B., Clare, A. S. 2011 Real-time quantification of microscale bioadhesion events in situ using imaging surface plasmon resonance (iSPR). ACS Appl. Mater. Interfaces 3, 2085-2091. (DOI 10.1021/am2003075)

[18] Petrone, L., Di Fino, A., Aldred, N., Sukkaew, P., Ederth, T., Clare, A. S., Liedberg, B. 2011 Effects of surface charge and Gibbs surface energy on the settlement behaviour of barnacle cyprids (Balanus amphitrite). Biofouling 27, 1043-1055. (DOI 10.1080/08927014.2011.625474)

[19] Petrone, L., Lee, S. S. C., Teo, S. L. M., Birch, W. R. 2013 A novel geometry for a laboratory-based larval settlement assay. Biofouling 29, 213-221. (DOI 10.1080/08927014.2012.762643)

[20] Di Fino, A., Petrone, L., Aldred, N., Ederth, T., Liedberg, B., Clare, A. S. 2013 Correlation between surface chemistry and settlement behaviour in barnacle cyprids (Balanus improvisus). Biofouling 30, 143-152. (DOI 10.1080/08927014.2013.852541) [21] Matsumura, K., Nagano, M., Fusetani, N. 1998 Purification of a larval settlement-inducing protein complex (SIPC) of the barnacle, Balanus amphitrite. J. Exp. Zool. 281, 12-20. (DOI 10.1002/(SICI)1097-010X(19980501)281:1<12::AID-JEZ3>3.0.CO;2-F) [22] Clare, A. S., Høeg, J. T. 2008. Balanus amphitrite or Amphibalanus amphitrite? A note on barnacle nomenclature. Biofouling 24,55–57. (DOI 10.1080/08927010701830194)

(17)

[23] Dreanno, C., Kirby, R. R., Clare, A. S. 2006 Locating the barnacle settlement pheromone: spatial and ontogenetic expression of the settlement-inducing protein complex of Balanus amphitrite. Proc. R. Soc. B. 273, 2721-2728. (DOI 10.1098/rspb.2006.3649)

[24] Liedberg, B., Lundstrom, I., Stenberg, E. 1993 Principles of biosensing with an extended coupling matrix and surface plasmon resonance. Sens. Actuators B Chem. 11, 63-72. (DOI 10.1016/0925-4005(93)85239-7)

[25] Höök, F., Kasemo, B., Nylander, T., Fant, C., Sott, K., Elwing, H. 2001 Variations in coupled water, viscoelastic properties, and film thickness of a Mefp-1 protein film during adsorption and cross-linking: a quartz crystal microbalance with dissipation monitoring, ellipsometry, and surface plasmon resonance study. Anal. Chem. 73, 5796-5804. (DOI 10.1021/ac0106501)

[26] Ramsden, J. J. Q. 1994 Experimental methods for investigating protein adsorption kinetics at surfaces Q. Rev. Biophys. 27, 41-105. (DOI 10.1017/S0033583500002900)

[27] Chapman, R. G., Ostuni, E., Takayama, S., Holmlin, R. E., Yan, L., Whitesides, G. M. 2000 Surveying for surfaces that resist the adsorption of proteins. Langmuir 122, 8303-8304. (DOI 10.1021/ja000774f)

[28] Back, S. A., Alhadeff, J. A. 1983 Differential isoelectric focusing properties of crude and purified human alpha 2-macroglobulin and alpha 2-macroglobulin-proteinase complexes. J. Chromatogr. B 278, 43-51. (DOI 10.1016/S0378-4347(00)84754-4.)

[29] Stewart, R. J., Wang, C. S., Shao, H. 2011 Complex coacervates as a foundation for synthetic underwater adhesives. Adv. Colloid Interface Sci. 167, 85–93. (DOI 10.1016/j.cis.2010.10.009)

[30] Petrone, L. 2013. Molecular surface chemistry in marine bioadhesion. Adv. Colloid

Interface Sci. 195-196:1-18. (DOI 10.1016/j.cis.2013.03.006)

[31] Yu, J., Wei, W., Danner, E., Ashley, R. K., Israelachvili, J. N., Waite, J. H. 2011 Mussel protein adhesion depends on interprotein thiol-mediated redox modulation. Nat.

Chem. Biol. 7, 588-590. (DOI 10.1038/nchembio.630)

[32] Jonker, J. L., von Byern, J., Flammang, P., Klepal, W., Power, A. M. 2012 Unusual adhesive production system in the barnacle Lepas anatifera; an ultrastructural and histochemical investigation. J. Morphol 273, 1377-1391. (DOI 10.1002/jmor.20067) [33] Rabe, M., Verdes, D., Seeger, S. 2011 Understanding protein adsorption phenomena at solid surfaces. Adv. Colloid Interface Sci. 162, 87-106. (DOI 10.1016/j.cis.2010.12.007)

[34] Wertz, C. F., Santore, M. M. 2002 Adsorption and reorientation kinetics of lysozyme on hydrophobic surfaces. Langmuir 18, 1190-1199. (DOI 10.1021/la0108813)

(18)

[35] Daly, S. M., Przybycien T. M., Tilton R. D. 2003 Coverage-dependent orientation of lysozyme adsorbed on silica. Langmuir 19, 3848-3857. (DOI 10.1021/la026690x) [36] Ohshima, H., Fujita, N., Kondo, T. 1992 Adsorption kinetics with time delay.

Colloid Polym. Sci. 270, 707-710. (DOI 10.1007/BF00654047)

[37] Karlsson, M., Ekeroth, J., Elwing, H., Carlsson, U. 2005 Reduction of irreversible protein adsorption on solid surfaces by protein engineering for increased stability. J.

Biol. Chem. 280, 25558-25564. (DOI 10.1074/jbc.M503665200)

[38] O’Shannessy, D. J., Brigham-Burke, M., Soneson, K. K., Hensley, P., Brooks, I. 1993 Determination of rate and equilibrium binding constants for macromolecular interactions using surface plasmon resonance: use of nonlinear least squares analysis methods. Anal. Biochem. 212, 457-468. (DOI 10.1006/abio.1993.1355)

[39] Schuck, P. 1997 Use of surface plasmon resonance to probe the equilibrium and dynamic aspects of interactions between biological macromolecules. Ann. Rev.

Biophys. Biomol. Struct. 26, 541-566. (DOI 10.1146/annurev.biophys.26.1.541)

[40] Gohad, N. V., Aldred, N., Hartshorn, C. M., Lee, Y. J., Cicerone, M. T., Orihuela, B., Clare, A. S., Rittschof, D., Mount, A. S. 2014 Synergistic roles for lipids and proteins in the permanent adhesive of barnacle larvae. Nat. Commun. 5, 4414. (DOI 10.1038/ncomms5414)

[41] Guerette, P. A., Hoon, S., Seow, Y., Raida, M., Masic, A., Wong, F. T., Ho, V. H. B., Kong, K. W., Demirel, M. C., Pena-Francesch, A., et al. 2013 Accelerating the design of biomimetic materials by integrating RNA-seq with proteomics and materials science. Nat. Biotechnol. 31, 908-915. (DOI 10.1038/nbt.2671)

[42] Guerrette, P. A., Hoon, S., Ding, D., Amini, S., Masic, A., Ravi, V., Venkatesh, B., Weaver, J. C., Miserez, A. 2014 Nanoconfined β-sheets mechanically reinforce the supra-biomolecular network of robust squid sucker ring teeth. ACS Nano 8, 7170-7179. (DOI 10.1021/nn502149u)

(19)

Figure 1. SPR data for the adsorption of fibrinogen, SIPC and α2-macroglobulin (A2M) on a series of SAMs. Data are absolute changes in resonance units (ΔRU) after a 3 min injection of 0.1 mg/mL protein solutions at pH 8.3, at 10 μL/min flow rate and 25 °C, followed by 5-min 0.05 M Tris-base buffer wash. Standard errors were from three replicate SPR experiments.

(20)

Figure 2. SPR sensorgrams for the adsorption of SIPC on N(CH3)3+ SAM at 0.1, 0.05,

0.025, 0.0125 and 0.005 mg/mL at pH 8.3, 10 μL/min flow rate and 25 °C. After 3 min protein injection, desorption phase followed by 0.05 M Tris-base buffer wash.

(21)

Figure 3. SPR sensorgrams for the adsorption of SIPC on COO- SAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3, 10 μL/min flow rate and 25 °C. After 3 min protein injection, desorption phase followed by 0.05 M Tris-base buffer wash.

(22)

Figure 4. SPR sensorgrams for the adsorption of SIPC on CH3SAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3, 10 μL/min flow rate and 25 °C. After 3 min protein injection, desorption phase followed by 0.05 M Tris-base buffer wash.

(23)

Figure 5. SPR sensorgrams for the adsorption of SIPC on OHSAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3, 10 μL/min flow rate and 25 °C. After 3 min protein injection, desorption phase followed by 0.05 M Tris-base buffer wash.

(24)

Figure 6. SPR sensorgrams for the adsorption of SIPC on OEGSAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3, 10 μL/min flow rate and 25 °C. After 3 min protein injection, desorption phase followed by 0.05 M Tris-base buffer wash.

(25)

Figure 7. SIPC adsorption rates during (a) t1-t2 and (b) t1-t5 intervals for five SIPC bulk concentrations (0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL) on the SAMs reported in the legend. Linear fits to the rates for each SAM are reported by the dashed lines along with their corresponding equations.

(26)

Figure 8. Schematic of the mechanism of overshooting effect observed for the

adsorption of SIPC on the N(CH3)3+ SAM. Adsorbed proteins can undergo (a)

reorentational and/or (b) conformational changes, displacing neighbouring adsorbed proteins and increasing their surface contact area.

(27)

Table 1. Slopes and corresponding linear correlation coefficients (r) of the linear fitting

in Figure 7 for the adsorption of SIPC on the investigated SAM surfaces during t1-t2 and t1-t5 intervals.

SAM surface t1–t2 slope t1–t5 slope

–N(CH3)3+ 592 (r = 0.99092) 430 (r = 0.99272)

–CH3 300 (r = 0.99678) 177 (r = 0.97288)

–COO- 226 (r = 0.99383) 126 (r = 0.99526)

–OH 94 (r = 0.9867) 45 (r = 0.98212)

(28)

Electronic Supplementary Information

Chemistry-specific surface adsorption of the barnacle settlement-inducing protein complex (SIPC)

Luigi Petrone1,3, Nick Aldred2, Kaveh Emami2, Karin Enander1, Thomas

Ederth1 & Anthony S. Clare2*

1Division of Molecular Physics, Department of Physics, Chemistry and Biology (IFM),

Linköping University, SE-58183 Linköping, Sweden.

2School of Marine Science and Technology, Newcastle University, NE1 7RU, UK.

3Current address: School of Materials Science and Engineering, Nanyang Technological

University, Singapore.

*Corresponding author: tony.clare@ncl.ac.uk

The Figures 1-5 on the following pages show the initial 6 seconds of adsorption of the SIPC on each of the tested SAM surfaces. The initial intervals (t1-t2 and t1-t5) were

(29)

Figure 1. SPR sensorgrams for the initial 6 s of SIPC adsorption on N(CH3)3+ SAM at

0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3.

Figure 2. SPR sensorgrams for the initial 6 s of SIPC adsorption on COO- SAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3.

(30)

Figure 3. SPR sensorgrams for the initial 6 s of SIPC adsorption on CH3SAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3.

Figure 4. SPR sensorgrams for the initial 6 s of SIPC adsorption on OHSAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3.

(31)

Figure 5. SPR sensorgrams for the initial 6 s of SIPC adsorption on OEGSAM at 0.1, 0.05, 0.025, 0.0125 and 0.005 mg/mL at pH 8.3.

Figure 6. Percentage of desorbed SIPC from the five SAMs (CH3, COO-, N(CH 3)3+,

(32)

Figure 7. Alignment of the coding sequence of the SIPC from (Amphibalanus amphitrite) and

the monomer A2M (Homo sapiens) generated by ClustalW2. Identical amino acid sites are boxed in black.

* (asterisc) indicates positions which have a single, fully conserved residue; : (column) indicates conservation between groups of strongly similar properties scoring >0.5 in the Gonnet PAM 250 matrix; . (full stop) indicates conservation between groups of weakly similar properties scoring ≤0.5 in the Gonnet PAM 250 matrix. Amino acid side chain colour code: red indicates small and hydrophobic; blue indicates acidic; magenta indicates basic; green indicates hydroxyl, sulphydryl, and amine side chains.

SIPC ---MGGPVVVLLVALATASAVKVPESGYLFTAPKVLQAGTDERACLS 44 A2M MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVL 50 : .:*:**:.* .:.* :. *:. .*.:*:: * *:.*: SIPC LFNLPGPNRALKLKFYERDVPSSLSTTLDKSDFLLFETNTAVPDSVAENG 94 A2M LSYLN-ETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNE- 98

* * . ::. .: . ** * *: .: :*. . ***.* ::: SIPC EYCFDITIPSKVVARSADMHMELTAGEGVWKEESVVTLKSETFLTLVQTD 144 A2M ---EVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTD 134

. : :::.. :*:.:.* :*.* *.:**** SIPC KSKYQPGQKVLFRVVTLSHDLTALNNDLNEVWITTPDNIRVAQWKNVKTN 194

A2M KSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLE 184

** *:***.* ****::..:: .**: : *:* *.. *:***:..: : SIPC TGMVQLELQLTEEPPLGSWTIHVLTTQDTYTKR-FTVEEYVLPTFELEIE 243

A2M GGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVT 234

*: *:.: *:.** **:.: * .... *:: *****:***.**::: SIPC APESLESNEKTVTVKVCAKYTFGKPLIAANVSINATARGIGSWQYNNNPD 293 A2M VPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQ 284

.*: : *: :.*.**. **:***: . . . . .* :.::.: SIPC LLRNISDYQFSDEQGCAIFDLVVSKIGIGHRNIGGGNTVIITIDVEEQGT 343

A2M AFCEKFSGQLN-SHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVV 333

: : . *:. .:** :: .. : : ::: . *: * . SIPC GLRQVEVKEVSQAYSFINLRQSDNAQKFLKPKLPFYGEYTLSMRDGKAAK 393 A2M ELTGRQSSEITRTITKLSFVKVD---SHFRQGIPFFGQVRLVDGKGVPIP 380 * : .*:::: : :.: : * ..:: :**:*: * .* . SIPC NEIVKVCYTAKYKERVISDEKKPTPDDPVYSTHKKYESHVKTEFGYTPFF 443

A2M NKVIFIR---GNEANYYSNATTDEHGLVQFSINTTN 413

*::: : ::. * :: . :.* .:*. .. SIPC WETSEPNRRTTGGECREYKTDENGRIVYYIPPQAEDIDSIDISTSTSVGG 493 A2M VMGTSLTVRVN---YKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVH 460 :. . *.. :: .. . : * :*.. : :*.*.*. SIPC DSDSSHSTLTAFFSPSHSYLSIDAHELPEQLPCSGDVTVKLLSTEEGPVP 543 A2M LEPMSHELPCGHTQTVQAHYILNGGTLLGLKKLS---FYYLIMAKGGIVR 507 . **. .. .. ::: ::. * * *: :: * * SIPC AMVYKILSRGKIIKAGNMNTNTLTFPVLPKMGPEFKLLVYYIKESGEVVS 593

A2M TGTHGLLVKQEDMKG----HFSISIPVKSDIAPVARLLIYAVLPTGDVIG 553

(33)

SIPC DSRVFKVDKCFPNTVQVSWDQKTVKPGDSASFTVRASPNSVCGISAVDKS 643

A2M DSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQS 603

** :.*::*:.*.*::*:. . *.. * : * *:*:***.: ***:* SIPC TELLGTSNQITLDTVFSKLQQFIINSFESPNQVRSDGDYCRELQLSLVDT 693 A2M VLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGI 653

. *: .. ::: .:*:. * : :..* .* : :.* * .. :: : . SIPC LRSGGATVAELTGQSTPEGTPESETSGAAHSSLFIPPPTRSQRFRTDRED 743

A2M TYTPVSSTNEKD--- 665

: ::. * SIPC AIKPFDEAGFLVLSNLALETRPCYKRVEAKELPELTEDKIQASRDGEEEL 793 A2M ---MYSFLEDMGLKAFTNSKIRKPKMCPQLQ 693 *. :* * :*:.**: .: : SIPC LDDLDSPVPALAFSKESADASRFAAEGGVSGGGGAAPPQEDQVRDFFPEA 843

A2M QYEMHGPEGLRVGFYESDVMGRGHAR---LVHVEEPHTETVRKYFPET 738

::..* . ** .* *. . *: : **.:***: SIPC FLFSIETLDAEGVKTVTSEMPDTITSWVGSAICTNSKDGFGISNKTSITT 893 A2M WIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRA 788

:::.: .::: ** * :*****.* ..*:* ... *:***..:*: : SIPC FKPFFTEVSLPYSMKRGEILSMSVSVFNFLDSSLSVYLEVGASDQYEIS- 942 A2M FQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVP 838

*:***.*:::***: *** :::..:*:*:* ..: * ::: ** : SIPC -GEVAMGLCIAAGRTEVRSFPVNFLGLGEVNITVTARAQDG--YCDEGNT 989

A2M VEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVP 888

: **.*. :. *:.*. .**:**:**:*.* :. *. . SIPC IAPGS---DTVIRPIVVKPEGFPQEVTHSRFICLDKDDDHHTETVNLPVP 1036

A2M SVPEHGRKDTVIKPLLVEPEGLEKETTFNSLLCPSGGE--VSEELSLKLP 936

.* ****:*::*:***: :*.*.. ::* . .: :* :.* :* SIPC EGLVPDSQRAYFSVIGDLLGQTFQGLEGGLIKSPTGAGEPNMITLVPNIY 1086

A2M PNVVEESARASVSVLGDILGSAMQNTQN-LLQMPYGCGEQNMVLFAPNIY 985

.:* :* ** .**:**:**.::*. :. *:: * *.** **: :.**** SIPC IRRYLETTGQLNERQRRQLEHNMKSGYQRQLRFRRYDGSFSSYGNED--P 1134

A2M VLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRN 1035

: **: * **. . : : :::******.:::****:*::*:. SIPC QGSMWLTAFVVKAFREASEYIEIDETIINKAKDWILKKQNTTGCFPRFGE 1184

A2M QGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGS 1085

**. ******:*:* :* ** ***: *.:* *: ::*: .*** *. SIPC LIHKELKGGTERGGEAALTAFVMLALKDIATTN---ELANGFACLEDGLL 1231 A2M LLNNAIKGGVED--EVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWK 1133 *::: :***.* *.:*:*:: :** :*. * : *.: ***.. SIPC LPN---KTLYSEILLAYTYLNMGQDVKGERLVNKLMSKAKREGDDILY 1276

A2M TAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHW 1183

.: . :*:: ****:: *:: * :.:::.* .:* ::.:.: : SIPC WEGDRDSLFGG---SRAVDVEMTAYMALSLMHIS---GKGNMEEAAR 1317

A2M ERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATN 1233

. :: . * : :.:****:*: *: : . . :: .*:. SIPC AIRWINTQRNSNGGFKSTQDTIVAVEALSEFASRTFASD--LATSVSVTA 1365 A2M IVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSS 1283 ::**..*:*::***.*****:**:.***::.: **: * . ::

(34)

SIPC GGETVQRMVDGDNRLLYQESKVPDLTLPGTMNFDVSPPGCVVYQSIFRFS 1415

A2M GTFSSKFQVDNNNRLLLQQVSLP--ELPGEYSMKVTGEGCVYLQTSLKYN 1331

* : : **.:**** *: .:* *** .:.*: *** *: :::. SIPC STLEVPDPAFSLGVAAK---KRGRTGYELEVCTSFLRNSGAVDRAIL 1459 A2M ILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIV 1381 * : .*:*** : :.:*.:::.:..*: . .* : **: SIPC ETELPSGYVAVDSTLRDLRRGSAVRSYEIKEGKVIFTLQGVAEDKTCLEF 1509 A2M DVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFF 1431 :.:: **::.:..*:: *.*.. * *:...:*:: *: *:::. .* * SIPC RIIQENEVEQLKPSIVKVHDFYRPEERNIQEYELTPAA--- 1547 A2M TVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA 1474 ::*: *.:***:****:*:*..:* * **: . :

(35)

Table 1. Tukey pairwise comparisons of SPR data relating to protein, surface

and the interaction between the two. Significant differences (ANOVA α = 0.05) between combinations of factors that do not share a letter A-F.

Factor 1 Factor 2 n Mean Grouping Protein Fibrinogen 15 1705 A SIPC 15 1370 B A2M 15 778 C Surface N(CH3)3+ 9 2384 A COO- 9 1733 B CH3 9 1556 B OEG 9 398 C OH 9 349 C Interaction A2M N(CH3)3+ 3 2890 A Fibrinogen COO- 3 2650 A Fibrinogen CH3 3 2480 AB Fibrinogen N(CH3)3+ 3 2159 BC SIPC N(CH3)3+ 3 2103 BC SIPC COO- 3 2060 BC SIPC CH3 3 1749 C Fibrinogen OEG 3 643 D Fibrinogen OH 3 593 D SIPC CH3 3 536 D A2M COO- 3 490 DE A2M CH3 3 441 DEF SIPC OH 3 401 DEF A2M OEG 3 54 EF A2M OEG 3 15 F

(36)

Table 2. Amino acid composition of the SIPC and A2M. Amino acid name SIPC total (%) A2M total (%)

Ala (A) 99 (6.4%) 93 (6.3%) Arg (R) 74 (4.8%) 46 (3.1%) Asn (N) 61 (3.9%) 63 (4.3%) Asp (D) 88 (5.7%) 54 (3.7%) Cys (C) 20 (1.3%) 25 (1.7%) Gln (Q) 53 (3.4%) 73 (5.0%) Gly (G) 112 (7.2%) 91 (6.2%) His (H) 17 (1.1%) 40 (2.7%) Ile (I) 76 (4.9%) 57 (3.9%) Leu (L) 133 (8.6%) 143 (9.7%) Lys (K) 84 (5.4%) 89 (6.0%) Met (M) 24 (1.6%) 26 (1.8%) Phe (F) 71 (4.6%) 62 (4.2%) Pro (P) 77 (5.0%) 78 (5.3%) Ser (S) 130 (8.4%) 123 (8.3%) Thr (T) 121 (7.8%) 101 (6.9%) Trp (W) 12 (0.8%) 11 (0.7%) Tyr (Y) 49 (3.2%) 56 (3.8%) Val (V) 120 (7.8%) 139 (9.4%)

References

Related documents

In paper V the objective was to (i) investigate the importance of the inherent ability of surfactants to form liquid crystalline structures for the lubrication properties and (ii)

The organic semiconductor PEDOT:PSS was used as the material for the transistor channel and the gate electrode was made of carbon bulk modified with the different redox

III The aim of this study was to use RNA-seq to guide analysis of protein expression in a four-step cell model for malignant transformation, called the BJ model..

Therefore, most proteomics experiments today are performed by different MS technologies, but antibodies and other affinity reagents remain as the number one choice for protein

As shown, a good correlation can be observed across all the genes in each of the tissues and cells suggesting that the RNA levels can be used to predict the corresponding protein

Answer: It is acceptable to e-mail an invoice according to our security policy but the human interaction regarding the encryption function may be a security risk.. Is the fact that

Ulrika säger: ”jag har utbildat folk som [jag] under utbildningen har vetat att jag och dom andra ledarna kommer att vara verksamhetsledare för och uppföljningen där har varit

Precision measurements were performed using two different graphene devices, and one GaAs device.. The graphene devices were used at 4.2 K, while the GaAs de- vice was used at